Lineage for d5hdib_ (5hdi B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (81 species)
    not a true protein
  7. 2331968Species Mycobacterium tuberculosis [TaxId:1773] [316963] (2 PDB entries)
  8. 2331970Domain d5hdib_: 5hdi B: [316999]
    automated match to d3vrma_
    complexed with hem

Details for d5hdib_

PDB Entry: 5hdi (more details), 1.54 Å

PDB Description: structural characterization of cyp144a1, a mycobacterium tuberculosis cytochrome p450
PDB Compounds: (B:) Cytochrome P450 144

SCOPe Domain Sequences for d5hdib_:

Sequence, based on SEQRES records: (download)

>d5hdib_ a.104.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tffgaesvqdpyplyermraagsvhriansdfyavcgwdavneaigrpedfssnltatmt
ytaegtakpfemdplggpthvlataddpahavhrklvlrhlaakrirvmeqftvqaadrl
wvdgmqdgciewmgamanrlpmmvvaeliglpdpdiaqlvkwgyaatqlleglvendqlv
aagvalmelsgyifeqfdraaadprdnllgelatacasgeldtltaqvmmvtlfaagges
taallgsavwilatrpdiqqqvranpellgafieetlryeppfrghyrhvrnattldgte
lpadshllllwgaanrdpaqfeapgefrldraggkghisfgkgahfcvgaalarleariv
lrllldrtsvieaadvggwlpsilvrrierlelavq

Sequence, based on observed residues (ATOM records): (download)

>d5hdib_ a.104.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tffgaesvqdpyplyermraagsvhriansdfyavcgwdavneaigrpedfssnltatmt
ytaegtakpfemdplggpthvlataddpahavhrklvlrhlaakrirvmeqftvqaadrl
wvdgmqdgciewmgamanrlpmmvvaeliglpdpdiaqlvkwgyaatqlleglvendqlv
aagvalmelsgyifeqfdraaadprdnllgelatacasgeldtltaqvmmvtlfaagges
taallgsavwilatrpdiqqqvranpellgafieetlryeppfrghyrhvrnattldgte
lpadshllllwgaanrdpaqfeapgefrldrkghisfgkgahfcvgaalarlearivlrl
lldrtsvieaadvggwlpsilvrrierlelavq

SCOPe Domain Coordinates for d5hdib_:

Click to download the PDB-style file with coordinates for d5hdib_.
(The format of our PDB-style files is described here.)

Timeline for d5hdib_: