Lineage for d5iqqe_ (5iqq E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952471Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2952472Protein automated matches [190896] (11 species)
    not a true protein
  7. 2952511Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)
  8. 2952590Domain d5iqqe_: 5iqq E: [316998]
    automated match to d1d8za_
    protein/RNA complex

Details for d5iqqe_

PDB Entry: 5iqq (more details), 2.52 Å

PDB Description: crystal structure of the human rbm7 rrm domain
PDB Compounds: (E:) RNA-binding protein 7

SCOPe Domain Sequences for d5iqqe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iqqe_ d.58.7.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvnfkhevsvpy
amnllngiklygrpikiqfr

SCOPe Domain Coordinates for d5iqqe_:

Click to download the PDB-style file with coordinates for d5iqqe_.
(The format of our PDB-style files is described here.)

Timeline for d5iqqe_: