Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
Protein automated matches [190896] (11 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188315] (87 PDB entries) |
Domain d5iqqb_: 5iqq B: [316997] automated match to d1d8za_ protein/RNA complex |
PDB Entry: 5iqq (more details), 2.52 Å
SCOPe Domain Sequences for d5iqqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iqqb_ d.58.7.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} adrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvnfkhevsvpyam nllngiklygrpikiqfr
Timeline for d5iqqb_:
View in 3D Domains from other chains: (mouse over for more information) d5iqqa_, d5iqqc_, d5iqqd_, d5iqqe_ |