Lineage for d5ik1a_ (5ik1 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2007940Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2007941Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2007942Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 2008211Protein Cytochrome P450-CAM [48266] (1 species)
  7. 2008212Species Pseudomonas putida [TaxId:303] [48267] (115 PDB entries)
    Uniprot P00183
  8. 2008278Domain d5ik1a_: 5ik1 A: [316996]
    automated match to d1qmqa_
    complexed with cam, hem

Details for d5ik1a_

PDB Entry: 5ik1 (more details), 1.53 Å

PDB Description: open state of p450cam after soaking in camphor
PDB Compounds: (A:) Camphor 5-monooxygenase

SCOPe Domain Sequences for d5ik1a_:

Sequence, based on SEQRES records: (download)

>d5ik1a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
anlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrg
qlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdkle
nriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpd
gsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvg
gldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefh
gvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreii
vtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

Sequence, based on observed residues (ATOM records): (download)

>d5ik1a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
anlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrg
qlireayedyrhfssecpfipsmdppeqrqfralanqvvgmpvvdklenriqelacslie
slrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgsmtfaeakeal
ydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggldtvvnflsfs
meflakspehrqelierperipaaceellrrfslvadgriltsdyefhgvqlkkgdqill
pqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiivtlkewltripd
fsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d5ik1a_:

Click to download the PDB-style file with coordinates for d5ik1a_.
(The format of our PDB-style files is described here.)

Timeline for d5ik1a_: