SCOPe 2.08: Domain d5i9qc1: 5i9q C:1-99

Lineage for d5i9qc1 (5i9q C:1-99)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5i9qc1: 5i9q C:1-99 [316993]
   Other proteins in same PDB: d5i9qc2, d5i9ql2
   automated match to d1dn0a1
   complexed with edo, nag, pge

Details for d5i9qc1

PDB Entry: 5i9q, 3 Å

PDB Description: crystal structure of 3bnc55 fab in complex with 426c.tm4deltav1-3 gp120

PDB Compounds: (C:) 3BNC55 light chain

SCOPe Domain Sequences for d5i9qc1:

Sequence; same for both SEQRES and ATOM records:

>d5i9qc1 b.1.1.0 (C:1-99) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdkvtitcqtsagylnwyqqrrgrapkllmydgsrlvtgvpsrfs
grrwgtqynltigslqpediatyycqvyeffgpgtrldl

Timeline for d5i9qc1:

• d5i9qc1 first appeared in SCOPe 2.06
  
• d5i9qc1 appears in SCOPe 2.07