SCOPe 2.08: Domain d5etlc1: 5etl C:0-158

Lineage for d5etlc1 (5etl C:0-158)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family)
   common fold is elaborated with additional secondary structures
   automatically mapped to Pfam PF01288

5. Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein)

6. Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (4 species)

7. Species Escherichia coli [TaxId:562] [55086] (49 PDB entries)
   Uniprot P26281

8. Domain d5etlc1: 5etl C:0-158 [316985]
   Other proteins in same PDB: d5etla2, d5etlb2, d5etlc2, d5etld2
   automated match to d4m5ia_
   complexed with 5rv, atp, ca

Details for d5etlc1

PDB Entry: 5etl, 1.82 Å

PDB Description: e. coli 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.82 angstrom resolution

PDB Compounds: (C:) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase

SCOPe Domain Sequences for d5etlc1:

Sequence, based on SEQRES records:

>d5etlc1 d.58.30.1 (C:0-158) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli [TaxId: 562]}
mtvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaava
letslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmk
nrgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw

Sequence, based on observed residues (ATOM records):

>d5etlc1 d.58.30.1 (C:0-158) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli [TaxId: 562]}
mtvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaava
letslapeellnhtqrielqqgrvrkaprtldldimlfgnevinterltvphydmknrgf
mlwplfeiapelvfpdgemlrqilhtrafdklnkw

Timeline for d5etlc1:

• d5etlc1 first appeared in SCOPe 2.06
  
• d5etlc1 appears in SCOPe 2.07