Lineage for d5emua_ (5emu A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2420459Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2420460Family c.1.10.1: Class I aldolase [51570] (13 protein domains)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2421010Protein automated matches [190095] (23 species)
    not a true protein
  7. 2421107Species Escherichia coli [TaxId:83333] [277890] (10 PDB entries)
  8. 2421111Domain d5emua_: 5emu A: [316984]
    automated match to d1p1xa_
    complexed with 1bo, epe; mutant

Details for d5emua_

PDB Entry: 5emu (more details), 1.5 Å

PDB Description: crystal structure of deoxyribose-phosphate aldolase from escherichia coli (k58e-y96w mutant) after acetaldehyde treatment and heating
PDB Compounds: (A:) deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d5emua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5emua_ c.1.10.1 (A:) automated matches {Escherichia coli [TaxId: 83333]}
dlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiaretlke
qgtpeiriatvtnfphgnddidialaetraaiawgadevdvvfpyralmagneqvgfdlv
kackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatpesa
rimmevirdmgvektvgfkpaggvrtaedaqkylaiadelfgadwadarhyrfgasslla
sllkalghg

SCOPe Domain Coordinates for d5emua_:

Click to download the PDB-style file with coordinates for d5emua_.
(The format of our PDB-style files is described here.)

Timeline for d5emua_: