Lineage for d5fecl1 (5fec L:3-102)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758530Domain d5fecl1: 5fec L:3-102 [316982]
    Other proteins in same PDB: d5fecb2, d5fecl2
    automated match to d1dn0a1
    complexed with nag

Details for d5fecl1

PDB Entry: 5fec (more details), 3.17 Å

PDB Description: crystal structure of 3bnc60 fab germline precursor in complex with 426c.tm4deltav1-3 gp120
PDB Compounds: (L:) germline 3BNC60 light chain

SCOPe Domain Sequences for d5fecl1:

Sequence, based on SEQRES records: (download)

>d5fecl1 b.1.1.0 (L:3-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgvpsrf
sgsgsgtdftftisslqpediatyycqqyefigpgtkvdi

Sequence, based on observed residues (ATOM records): (download)

>d5fecl1 b.1.1.0 (L:3-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qmtqspsslsasvgdrvtitcqaisnylnwyqqkpgkapklliydasnletgvpsrfsgs
gsgtdftftisslqpediatyycqqyefigpgtkvdi

SCOPe Domain Coordinates for d5fecl1:

Click to download the PDB-style file with coordinates for d5fecl1.
(The format of our PDB-style files is described here.)

Timeline for d5fecl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5fecl2