SCOPe 2.08: Domain d5etoa_: 5eto A:

Lineage for d5etoa_ (5eto A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family)
   common fold is elaborated with additional secondary structures
   automatically mapped to Pfam PF01288

5. Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein)

6. Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (4 species)

7. Species Escherichia coli [TaxId:562] [55086] (49 PDB entries)
   Uniprot P26281

8. Domain d5etoa_: 5eto A: [316981]
   automated match to d4m5ia_
   complexed with 5ry, apc, ca, cl

Details for d5etoa_

PDB Entry: 5eto, 1.07 Å

PDB Description: e. coli 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.07 angstrom resolution

PDB Compounds: (A:) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase

SCOPe Domain Sequences for d5etoa_:

Sequence; same for both SEQRES and ATOM records:

>d5etoa_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli [TaxId: 562]}
mtvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaava
letslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmk
nrgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw

Timeline for d5etoa_:

• d5etoa_ first appeared in SCOPe 2.06
  
• d5etoa_ appears in SCOPe 2.07