SCOPe 2.06: Domain d5erua3: 5eru A:654-736

Lineage for d5erua3 (5eru A:654-736)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families)
   automatically mapped to Pfam PF03454

5. Family b.85.6.0: automated matches [259258] (1 protein)
   not a true family

6. Protein automated matches [259259] (1 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [259260] (7 PDB entries)

8. Domain d5erua3: 5eru A:654-736 [316980]
   Other proteins in same PDB: d5erua1, d5erua2
   automated match to d2ftsa1
   complexed with act, adp, ca, mg, mo, moo, mpd, po4

Details for d5erua3

PDB Entry: 5eru, 1.6 Å

PDB Description: ternary complex of gephe - adp - molybdenum cluster

PDB Compounds: (A:) gephyrin

SCOPe Domain Sequences for d5erua3:

Sequence, based on SEQRES records:

>d5erua3 b.85.6.0 (A:654-736) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgnqmssrlmsmrsangllmlp
pkteqyvelhkgevvdvmvigrl

Sequence, based on observed residues (ATOM records):

>d5erua3 b.85.6.0 (A:654-736) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgsrlmsmrsangllmlppkte
qyvelhkgevvdvmvigrl

Timeline for d5erua3:

• d5erua3 is new in SCOPe 2.06-stable
  
• d5erua3 appears in SCOPe 2.07
  
• d5erua3 appears in the current release, SCOPe 2.08