SCOP 1.55: Domain d1bxra4: 1bxr A:556-676

Lineage for d1bxra4 (1bxr A:556-676)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)

4. Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families)

5. Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)

6. Protein Carbamoyl phosphate synthetase (CPS), large subunit [52450] (1 species)

7. Species Escherichia coli [TaxId:562] [52451] (7 PDB entries)

8. Domain d1bxra4: 1bxr A:556-676 [31698]
   Other proteins in same PDB: d1bxra1, d1bxra2, d1bxra5, d1bxra6, d1bxrb1, d1bxrb2, d1bxrc1, d1bxrc2, d1bxrc5, d1bxrc6, d1bxrd1, d1bxrd2, d1bxre1, d1bxre2, d1bxre5, d1bxre6, d1bxrf1, d1bxrf2, d1bxrg1, d1bxrg2, d1bxrg5, d1bxrg6, d1bxrh1, d1bxrh2

Details for d1bxra4

PDB Entry: 1bxr, 2.1 Å

PDB Description: structure of carbamoyl phosphate synthetase complexed with the atp analog amppnp

SCOP Domain Sequences for d1bxra4:

Sequence; same for both SEQRES and ATOM records:

>d1bxra4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli}
stdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvncnpetvstdydtsdr
lyfepvtledvleivriekpkgvivqyggqtplklaraleaagvpvigtspdaidraedr
e

Timeline for d1bxra4:

• d1bxra4 appears in SCOP 1.57
  
• d1bxra4 appears in the current release, SCOPe 2.08