Lineage for d5erua1 (5eru A:319-498)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2085723Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 2085724Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
    automatically mapped to Pfam PF03453
  5. 2085725Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins)
  6. 2085773Protein automated matches [259253] (1 species)
    not a true protein
  7. 2085774Species Norway rat (Rattus norvegicus) [TaxId:10116] [259254] (7 PDB entries)
  8. 2085777Domain d5erua1: 5eru A:319-498 [316978]
    Other proteins in same PDB: d5erua2, d5erua3
    automated match to d2ftsa2
    complexed with act, adp, ca, mg, mo, moo, mpd, po4

Details for d5erua1

PDB Entry: 5eru (more details), 1.6 Å

PDB Description: ternary complex of gephe - adp - molybdenum cluster
PDB Compounds: (A:) gephyrin

SCOPe Domain Sequences for d5erua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5erua1 b.103.1.1 (A:319-498) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
spfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgyav
raadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresdd
gteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnkf

SCOPe Domain Coordinates for d5erua1:

Click to download the PDB-style file with coordinates for d5erua1.
(The format of our PDB-style files is described here.)

Timeline for d5erua1: