![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily) complex fold made of bifurcated and coiled b-sheets |
![]() | Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) ![]() automatically mapped to Pfam PF03453 |
![]() | Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins) |
![]() | Protein automated matches [259253] (1 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [259254] (9 PDB entries) |
![]() | Domain d5ersa1: 5ers A:319-498 [316974] Other proteins in same PDB: d5ersa2, d5ersa3 automated match to d2ftsa2 complexed with act, amp, mg, mpd, po4 |
PDB Entry: 5ers (more details), 1.7 Å
SCOPe Domain Sequences for d5ersa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ersa1 b.103.1.1 (A:319-498) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} spfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgyav raadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresdd gteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnkf
Timeline for d5ersa1: