SCOPe 2.08: Domain d1bxra3: 1bxr A:1-127

Lineage for d1bxra3 (1bxr A:1-127)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)

6. Protein Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains [52450] (1 species)
   duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains

7. Species Escherichia coli [TaxId:562] [52451] (10 PDB entries)
   Uniprot P00968

8. Domain d1bxra3: 1bxr A:1-127 [31697]
   Other proteins in same PDB: d1bxra1, d1bxra2, d1bxra5, d1bxra6, d1bxrb1, d1bxrb2, d1bxrc1, d1bxrc2, d1bxrc5, d1bxrc6, d1bxrd1, d1bxrd2, d1bxre1, d1bxre2, d1bxre5, d1bxre6, d1bxrf1, d1bxrf2, d1bxrg1, d1bxrg2, d1bxrg5, d1bxrg6, d1bxrh1, d1bxrh2
   complexed with anp, cl, k, mn, net, orn

Details for d1bxra3

PDB Entry: 1bxr, 2.1 Å

PDB Description: structure of carbamoyl phosphate synthetase complexed with the atp analog amppnp

PDB Compounds: (A:) carbamoyl-phosphate synthase

SCOPe Domain Sequences for d1bxra3:

Sequence; same for both SEQRES and ATOM records:

>d1bxra3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]}
mpkrtdiksililgagpivigqacefdysgaqackalreegyrvilvnsnpatimtdpem
adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
daidkae

Timeline for d1bxra3:

• d1bxra3 first appeared (with stable ids) in SCOP 1.55
  
• d1bxra3 appears in SCOPe 2.07