Lineage for d5hhza2 (5hhz A:247-531)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2198038Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) (S)
    duplication: contains two subdomains of this fold
  5. 2198145Family d.58.32.0: automated matches [227166] (1 protein)
    not a true family
  6. 2198146Protein automated matches [226875] (3 species)
    not a true protein
  7. 2198147Species Maize (Zea mays) [TaxId:4577] [269671] (7 PDB entries)
  8. 2198152Domain d5hhza2: 5hhz A:247-531 [316969]
    Other proteins in same PDB: d5hhza1
    automated match to d4o95a2
    complexed with fad, zme

Details for d5hhza2

PDB Entry: 5hhz (more details), 2 Å

PDB Description: crystal structure of maize cytokinin oxidase/dehydrogenase 4 (zmcko4) in complex with 6-(3-methylpyrrol-1-yl)-9h-purine
PDB Compounds: (A:) Cytokinin dehydrogenase 4

SCOPe Domain Sequences for d5hhza2:

Sequence, based on SEQRES records: (download)

>d5hhza2 d.58.32.0 (A:247-531) automated matches {Maize (Zea mays) [TaxId: 4577]}
pkrvrwiralysnfseftadqerlislgsgggrrfdyvegfvvaaeglinnwrssffspq
npvkltslkhhssvlyclevtknyddetagsvdqdvdtllgelnflpgtvfttdlpyvdf
ldrvhkaelklrakgmwevphpwlnlfvpasriadfdrgvfrgvlggrtagaggpvliyp
mnkhkwdprssavtpdeevfylvaflrsalpgapeslealarqnqrildfcagtgigakq
ylpghkarhewaehfgaarwdrfarlkaefdprailaagqgifrp

Sequence, based on observed residues (ATOM records): (download)

>d5hhza2 d.58.32.0 (A:247-531) automated matches {Maize (Zea mays) [TaxId: 4577]}
pkrvrwiralysnfseftadqerlislgrrfdyvegfvvaaeglslkhhssvlyclevtk
nyddetagsvdqdvdtllgelnflpgtvfttdlpyvdfldrvhkaelklrakgmwevphp
wlnlfvpasriadfdrgvfrgvlaggpvliypmnkhkwdprssavtpdeevfylvaflrs
alpgapeslealarqnqrildfcagtgigakqylpghkarhewaehfgaarwdrfarlka
efdprailaagqgifrp

SCOPe Domain Coordinates for d5hhza2:

Click to download the PDB-style file with coordinates for d5hhza2.
(The format of our PDB-style files is described here.)

Timeline for d5hhza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5hhza1