Lineage for d5evoa2 (5evo A:87-212)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2713907Species Cenchrus americanus [TaxId:4543] [316959] (1 PDB entry)
  8. 2713908Domain d5evoa2: 5evo A:87-212 [316960]
    Other proteins in same PDB: d5evoa1, d5evoa3
    automated match to d3uvhb2
    complexed with act, gol

Details for d5evoa2

PDB Entry: 5evo (more details), 2.51 Å

PDB Description: structure of dehydroascrobate reductase from pennisetum americanum in complex with two non-native ligands, acetate in the g-site and glycerol in the h-site
PDB Compounds: (A:) Dehydroascorbate reductase

SCOPe Domain Sequences for d5evoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5evoa2 a.45.1.0 (A:87-212) automated matches {Cenchrus americanus [TaxId: 4543]}
tpslvtppeyasvgskifpsfvkflkskdasdgsekalldelqaldehlkahgpyisgen
vsaadlslgpklfhlqvalehfkgwkipenltsvhaytkalfsresfvktkpanqyliag
wapkvn

SCOPe Domain Coordinates for d5evoa2:

Click to download the PDB-style file with coordinates for d5evoa2.
(The format of our PDB-style files is described here.)

Timeline for d5evoa2: