| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
| Protein automated matches [226831] (73 species) not a true protein |
| Species Cenchrus americanus [TaxId:4543] [316959] (1 PDB entry) |
| Domain d5evoa2: 5evo A:87-212 [316960] Other proteins in same PDB: d5evoa1, d5evoa3 automated match to d3uvhb2 complexed with act, gol |
PDB Entry: 5evo (more details), 2.51 Å
SCOPe Domain Sequences for d5evoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5evoa2 a.45.1.0 (A:87-212) automated matches {Cenchrus americanus [TaxId: 4543]}
tpslvtppeyasvgskifpsfvkflkskdasdgsekalldelqaldehlkahgpyisgen
vsaadlslgpklfhlqvalehfkgwkipenltsvhaytkalfsresfvktkpanqyliag
wapkvn
Timeline for d5evoa2: