SCOPe 2.07: Domain d5erta1: 5ert A:319-498

Lineage for d5erta1 (5ert A:319-498)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
   complex fold made of bifurcated and coiled b-sheets

4. Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family)
   automatically mapped to Pfam PF03453

5. Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins)

6. Protein automated matches [259253] (1 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [259254] (9 PDB entries)

8. Domain d5erta1: 5ert A:319-498 [316951]
   Other proteins in same PDB: d5erta2, d5erta3
   automated match to d2ftsa2
   complexed with act, adp, mn, mpd, po4

Details for d5erta1

PDB Entry: 5ert, 2 Å

PDB Description: gephe in complex with mn(2+) - adp

PDB Compounds: (A:) gephyrin

SCOPe Domain Sequences for d5erta1:

Sequence; same for both SEQRES and ATOM records:

>d5erta1 b.103.1.1 (A:319-498) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
spfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgyav
raadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresdd
gteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnkf

Timeline for d5erta1:

• d5erta1 first appeared in SCOPe 2.06