| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
| Protein automated matches [190140] (30 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (37 PDB entries) |
| Domain d5elva1: 5elv A:3-263 [316946] Other proteins in same PDB: d5elva2, d5elvb2 automated match to d5ftia_ complexed with 5px, act, cl, glu, gol, peg, so4 |
PDB Entry: 5elv (more details), 1.92 Å
SCOPe Domain Sequences for d5elva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5elva1 c.94.1.1 (A:3-263) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltityvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkls
eqglldklknkwwydkgecgs
Timeline for d5elva1: