Lineage for d5erva3 (5erv A:654-736)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818545Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families) (S)
    automatically mapped to Pfam PF03454
  5. 2818594Family b.85.6.0: automated matches [259258] (1 protein)
    not a true family
  6. 2818595Protein automated matches [259259] (1 species)
    not a true protein
  7. 2818596Species Norway rat (Rattus norvegicus) [TaxId:10116] [259260] (9 PDB entries)
  8. 2818604Domain d5erva3: 5erv A:654-736 [316944]
    Other proteins in same PDB: d5erva1, d5erva2
    automated match to d2ftsa1
    complexed with act, adp, ca, mg, mpd, w, wo4

Details for d5erva3

PDB Entry: 5erv (more details), 1.8 Å

PDB Description: ternary complex of gephe - adp - tungsten cluster
PDB Compounds: (A:) gephyrin

SCOPe Domain Sequences for d5erva3:

Sequence, based on SEQRES records: (download)

>d5erva3 b.85.6.0 (A:654-736) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgnqmssrlmsmrsangllmlp
pkteqyvelhkgevvdvmvigrl

Sequence, based on observed residues (ATOM records): (download)

>d5erva3 b.85.6.0 (A:654-736) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstsrlmsmrsangllmlppkteq
yvelhkgevvdvmvigrl

SCOPe Domain Coordinates for d5erva3:

Click to download the PDB-style file with coordinates for d5erva3.
(The format of our PDB-style files is described here.)

Timeline for d5erva3: