Lineage for d5erva2 (5erv A:499-653)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142860Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 2142861Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 2143003Family c.57.1.0: automated matches [191349] (1 protein)
    not a true family
  6. 2143004Protein automated matches [190284] (9 species)
    not a true protein
  7. 2143019Species Norway rat (Rattus norvegicus) [TaxId:10116] [259256] (7 PDB entries)
  8. 2143025Domain d5erva2: 5erv A:499-653 [316943]
    Other proteins in same PDB: d5erva1, d5erva3
    automated match to d2ftsa3
    complexed with act, adp, ca, mg, mpd, w, wo4

Details for d5erva2

PDB Entry: 5erv (more details), 1.8 Å

PDB Description: ternary complex of gephe - adp - tungsten cluster
PDB Compounds: (A:) gephyrin

SCOPe Domain Sequences for d5erva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5erva2 c.57.1.0 (A:499-653) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddllnal
negisradviitsggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldidgvr
kiifalpgnpvsavvtcnlfvvpalrkmqgildpr

SCOPe Domain Coordinates for d5erva2:

Click to download the PDB-style file with coordinates for d5erva2.
(The format of our PDB-style files is described here.)

Timeline for d5erva2: