Lineage for d5erva1 (5erv A:319-498)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409231Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 2409232Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
    automatically mapped to Pfam PF03453
  5. 2409233Family b.103.1.1: MoeA N-terminal region -like [63883] (3 protein domains)
  6. 2409281Protein automated matches [259253] (1 species)
    not a true protein
  7. 2409282Species Norway rat (Rattus norvegicus) [TaxId:10116] [259254] (7 PDB entries)
  8. 2409288Domain d5erva1: 5erv A:319-498 [316942]
    Other proteins in same PDB: d5erva2, d5erva3
    automated match to d2ftsa2
    complexed with act, adp, ca, mg, mpd, w, wo4

Details for d5erva1

PDB Entry: 5erv (more details), 1.8 Å

PDB Description: ternary complex of gephe - adp - tungsten cluster
PDB Compounds: (A:) gephyrin

SCOPe Domain Sequences for d5erva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5erva1 b.103.1.1 (A:319-498) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
spfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgyav
raadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresdd
gteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnkf

SCOPe Domain Coordinates for d5erva1:

Click to download the PDB-style file with coordinates for d5erva1.
(The format of our PDB-style files is described here.)

Timeline for d5erva1: