SCOPe 2.08: Domain d1ce8e4: 1ce8 E:556-676

Lineage for d1ce8e4 (1ce8 E:556-676)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)

6. Protein Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains [52450] (1 species)
   duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains

7. Species Escherichia coli [TaxId:562] [52451] (10 PDB entries)
   Uniprot P00968

8. Domain d1ce8e4: 1ce8 E:556-676 [31694]
   Other proteins in same PDB: d1ce8a1, d1ce8a2, d1ce8a5, d1ce8a6, d1ce8b1, d1ce8b2, d1ce8c1, d1ce8c2, d1ce8c5, d1ce8c6, d1ce8d1, d1ce8d2, d1ce8e1, d1ce8e2, d1ce8e5, d1ce8e6, d1ce8f1, d1ce8f2, d1ce8g1, d1ce8g2, d1ce8g5, d1ce8g6, d1ce8h1, d1ce8h2
   complexed with adp, cl, imp, k, mn, net, orn, po4

Details for d1ce8e4

PDB Entry: 1ce8, 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichis coli with complexed with the allosteric ligand imp

PDB Compounds: (E:) protein (carbamoyl-phosphate synthase)

SCOPe Domain Sequences for d1ce8e4:

Sequence; same for both SEQRES and ATOM records:

>d1ce8e4 c.30.1.1 (E:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]}
stdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvncnpetvstdydtsdr
lyfepvtledvleivriekpkgvivqyggqtplklaraleaagvpvigtspdaidraedr
e

Timeline for d1ce8e4:

• d1ce8e4 first appeared (with stable ids) in SCOP 1.55
  
• d1ce8e4 appears in SCOPe 2.07