![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family) ![]() common fold is elaborated with additional secondary structures automatically mapped to Pfam PF01288 |
![]() | Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein) |
![]() | Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [55086] (49 PDB entries) Uniprot P26281 |
![]() | Domain d5etpa1: 5etp A:0-158 [316937] Other proteins in same PDB: d5etpa2 automated match to d4m5ia_ complexed with 5rz, apc, ca, cl, na |
PDB Entry: 5etp (more details), 1.05 Å
SCOPe Domain Sequences for d5etpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5etpa1 d.58.30.1 (A:0-158) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli [TaxId: 562]} mtvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaava letslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmk nrgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw
Timeline for d5etpa1: