Lineage for d5erqa3 (5erq A:654-736)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2406647Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2407247Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families) (S)
    automatically mapped to Pfam PF03454
  5. 2407296Family b.85.6.0: automated matches [259258] (1 protein)
    not a true family
  6. 2407297Protein automated matches [259259] (1 species)
    not a true protein
  7. 2407298Species Norway rat (Rattus norvegicus) [TaxId:10116] [259260] (7 PDB entries)
  8. 2407299Domain d5erqa3: 5erq A:654-736 [316931]
    Other proteins in same PDB: d5erqa1, d5erqa2
    automated match to d2ftsa1
    complexed with act, mpd

Details for d5erqa3

PDB Entry: 5erq (more details), 1.55 Å

PDB Description: gephyrin e domain at 1.55 angstrom resolution
PDB Compounds: (A:) gephyrin

SCOPe Domain Sequences for d5erqa3:

Sequence, based on SEQRES records: (download)

>d5erqa3 b.85.6.0 (A:654-736) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgnqmssrlmsmrsangllmlp
pkteqyvelhkgevvdvmvigrl

Sequence, based on observed residues (ATOM records): (download)

>d5erqa3 b.85.6.0 (A:654-736) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgnqsrlmsmrsangllmlppk
teqyvelhkgevvdvmvigrl

SCOPe Domain Coordinates for d5erqa3:

Click to download the PDB-style file with coordinates for d5erqa3.
(The format of our PDB-style files is described here.)

Timeline for d5erqa3: