SCOPe 2.06: Domain d5erqa1: 5erq A:318-498

Lineage for d5erqa1 (5erq A:318-498)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
   complex fold made of bifurcated and coiled b-sheets

4. Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family)
   automatically mapped to Pfam PF03453

5. Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins)

6. Protein automated matches [259253] (1 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [259254] (7 PDB entries)

8. Domain d5erqa1: 5erq A:318-498 [316929]
   Other proteins in same PDB: d5erqa2, d5erqa3
   automated match to d2ftsa2
   complexed with act, mpd

Details for d5erqa1

PDB Entry: 5erq, 1.55 Å

PDB Description: gephyrin e domain at 1.55 angstrom resolution

PDB Compounds: (A:) gephyrin

SCOPe Domain Sequences for d5erqa1:

Sequence; same for both SEQRES and ATOM records:

>d5erqa1 b.103.1.1 (A:318-498) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya
vraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresd
dgteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnk
f

Timeline for d5erqa1:

• d5erqa1 is new in SCOPe 2.06-stable
  
• d5erqa1 appears in SCOPe 2.07
  
• d5erqa1 appears in the current release, SCOPe 2.08