SCOPe 2.08: Domain d5e3ja_: 5e3j A:

Lineage for d5e3ja_ (5e3j A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:557600] [316905] (1 PDB entry)

8. Domain d5e3ja_: 5e3j A: [316927]
   automated match to d5dcla_

Details for d5e3ja_

PDB Entry: 5e3j, 2.1 Å

PDB Description: the response regulator rsta is a potential drug target for acinetobacter baumannii

PDB Compounds: (A:) Response regulator RstA

SCOPe Domain Sequences for d5e3ja_:

Sequence; same for both SEQRES and ATOM records:

>d5e3ja_ c.23.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 557600]}
klpkilivedderlarltqeylirnglevgvetdgnrairriiseqpdlvvldvmlpgad
gltvcrevrphyhqpilmltartedmdqvlglemgaddyvakpvqprvllarirallrrt

Timeline for d5e3ja_:

• d5e3ja_ first appeared in SCOPe 2.06
  
• d5e3ja_ appears in SCOPe 2.07