Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) |
Family c.124.1.0: automated matches [191609] (1 protein) not a true family |
Protein automated matches [191112] (16 species) not a true protein |
Species Acetobacter aceti [TaxId:435] [226493] (16 PDB entries) |
Domain d5ddka2: 5ddk A:230-505 [316920] Other proteins in same PDB: d5ddka3 automated match to d4eu3a2 complexed with cl, coa, imd |
PDB Entry: 5ddk (more details), 2.13 Å
SCOPe Domain Sequences for d5ddka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ddka2 c.124.1.0 (A:230-505) automated matches {Acetobacter aceti [TaxId: 435]} apfaapdetakaiagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenl vgyseviqdgmlamldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsasp giirrlgciamngmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakg gkisaivpmaahvdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdy fdralknsfgkhtphlltealswhqrfidtgtmlps
Timeline for d5ddka2: