Lineage for d1ce8c4 (1ce8 C:556-676)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1161658Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1161659Superfamily c.30.1: PreATP-grasp domain [52440] (8 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1161660Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 1161687Protein Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains [52450] (1 species)
    duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains
  7. 1161688Species Escherichia coli [TaxId:562] [52451] (10 PDB entries)
    Uniprot P00968
  8. 1161756Domain d1ce8c4: 1ce8 C:556-676 [31692]
    Other proteins in same PDB: d1ce8a1, d1ce8a2, d1ce8a5, d1ce8a6, d1ce8b1, d1ce8b2, d1ce8c1, d1ce8c2, d1ce8c5, d1ce8c6, d1ce8d1, d1ce8d2, d1ce8e1, d1ce8e2, d1ce8e5, d1ce8e6, d1ce8f1, d1ce8f2, d1ce8g1, d1ce8g2, d1ce8g5, d1ce8g6, d1ce8h1, d1ce8h2
    complexed with adp, cl, imp, k, mn, net, orn, po4

Details for d1ce8c4

PDB Entry: 1ce8 (more details), 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichis coli with complexed with the allosteric ligand imp
PDB Compounds: (C:) protein (carbamoyl-phosphate synthase)

SCOPe Domain Sequences for d1ce8c4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ce8c4 c.30.1.1 (C:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]}
stdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvncnpetvstdydtsdr
lyfepvtledvleivriekpkgvivqyggqtplklaraleaagvpvigtspdaidraedr
e

SCOPe Domain Coordinates for d1ce8c4:

Click to download the PDB-style file with coordinates for d1ce8c4.
(The format of our PDB-style files is described here.)

Timeline for d1ce8c4: