Lineage for d5ddkb1 (5ddk B:2-229)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2529545Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2529546Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2529832Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2529833Protein automated matches [191112] (16 species)
    not a true protein
  7. 2529838Species Acetobacter aceti [TaxId:435] [226493] (16 PDB entries)
  8. 2529886Domain d5ddkb1: 5ddk B:2-229 [316912]
    Other proteins in same PDB: d5ddka3
    automated match to d4eu3a1
    complexed with cl, coa, imd

Details for d5ddkb1

PDB Entry: 5ddk (more details), 2.13 Å

PDB Description: succinyl-coa:acetate coa-transferase (aarch6-n347a) in complex with coa
PDB Compounds: (B:) Acetyl-CoA hydrolase

SCOPe Domain Sequences for d5ddkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ddkb1 c.124.1.0 (B:2-229) automated matches {Acetobacter aceti [TaxId: 435]}
terirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrgek
yqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagra
vqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegihd
iwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrn

SCOPe Domain Coordinates for d5ddkb1:

Click to download the PDB-style file with coordinates for d5ddkb1.
(The format of our PDB-style files is described here.)

Timeline for d5ddkb1: