Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.219: PP2C-like [81607] (1 superfamily) 4 layers: alpha/beta/beta/alpha; antiparallel beta sheets |
Superfamily d.219.1: PP2C-like [81606] (2 families) contain binuclear metal (Mn) centre |
Family d.219.1.0: automated matches [191371] (1 protein) not a true family |
Protein automated matches [190449] (7 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [316910] (2 PDB entries) |
Domain d5d2ua_: 5d2u A: [316911] automated match to d2j82a_ complexed with ca |
PDB Entry: 5d2u (more details), 1.8 Å
SCOPe Domain Sequences for d5d2ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d2ua_ d.219.1.0 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} mdvagltdcglirksnqdafyidekhqrffivadgmggaaggeeasrlavdhirqyleth ledlqhdpvtllrqaflaanhaiveqqrqnsaradmgttavvilldekgdrawcahvgds riyrwrkdqlqqitsdhtwiaqavqlgsltieqarqhpwrhvlsqclgredlsqidiqpi dlepgdrlllcsdglteeltddvisiylsepnvqkaaaalvdaakthggrdnvtvvvisv
Timeline for d5d2ua_: