Lineage for d5d2ua_ (5d2u A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007405Fold d.219: PP2C-like [81607] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; antiparallel beta sheets
  4. 3007406Superfamily d.219.1: PP2C-like [81606] (2 families) (S)
    contain binuclear metal (Mn) centre
  5. 3007425Family d.219.1.0: automated matches [191371] (1 protein)
    not a true family
  6. 3007426Protein automated matches [190449] (7 species)
    not a true protein
  7. 3007455Species Thermosynechococcus elongatus [TaxId:197221] [316910] (2 PDB entries)
  8. 3007456Domain d5d2ua_: 5d2u A: [316911]
    automated match to d2j82a_
    complexed with ca

Details for d5d2ua_

PDB Entry: 5d2u (more details), 1.8 Å

PDB Description: crystal structure of tppha variant - h39a
PDB Compounds: (A:) protein serin-threonin phosphatase

SCOPe Domain Sequences for d5d2ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d2ua_ d.219.1.0 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
mdvagltdcglirksnqdafyidekhqrffivadgmggaaggeeasrlavdhirqyleth
ledlqhdpvtllrqaflaanhaiveqqrqnsaradmgttavvilldekgdrawcahvgds
riyrwrkdqlqqitsdhtwiaqavqlgsltieqarqhpwrhvlsqclgredlsqidiqpi
dlepgdrlllcsdglteeltddvisiylsepnvqkaaaalvdaakthggrdnvtvvvisv

SCOPe Domain Coordinates for d5d2ua_:

Click to download the PDB-style file with coordinates for d5d2ua_.
(The format of our PDB-style files is described here.)

Timeline for d5d2ua_: