![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) ![]() |
![]() | Family c.124.1.0: automated matches [191609] (1 protein) not a true family |
![]() | Protein automated matches [191112] (17 species) not a true protein |
![]() | Species Acetobacter aceti [TaxId:435] [226493] (16 PDB entries) |
![]() | Domain d5dw4b2: 5dw4 B:230-505 [316895] Other proteins in same PDB: d5dw4a3 automated match to d4eu3a2 complexed with act, imd |
PDB Entry: 5dw4 (more details), 1.62 Å
SCOPe Domain Sequences for d5dw4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dw4b2 c.124.1.0 (B:230-505) automated matches {Acetobacter aceti [TaxId: 435]} apfaapdetakaiagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenl vgyseviqdgmlamldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsnsp giirrlgciamngmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakg gkisaivpmaahvdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdy fdralknsfgkhtphlltealswhqrfidtgtmlps
Timeline for d5dw4b2: