SCOP 1.61: Domain d1ce8a3: 1ce8 A:1-127

Lineage for d1ce8a3 (1ce8 A:1-127)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)

4. Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families)

5. Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)

6. Protein Carbamoyl phosphate synthetase (CPS), large subunit [52450] (1 species)

7. Species Escherichia coli [TaxId:562] [52451] (9 PDB entries)

8. Domain d1ce8a3: 1ce8 A:1-127 [31689]
   Other proteins in same PDB: d1ce8a1, d1ce8a2, d1ce8a5, d1ce8a6, d1ce8b1, d1ce8b2, d1ce8c1, d1ce8c2, d1ce8c5, d1ce8c6, d1ce8d1, d1ce8d2, d1ce8e1, d1ce8e2, d1ce8e5, d1ce8e6, d1ce8f1, d1ce8f2, d1ce8g1, d1ce8g2, d1ce8g5, d1ce8g6, d1ce8h1, d1ce8h2

Details for d1ce8a3

PDB Entry: 1ce8, 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichis coli with complexed with the allosteric ligand imp

SCOP Domain Sequences for d1ce8a3:

Sequence; same for both SEQRES and ATOM records:

>d1ce8a3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli}
mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem
adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
daidkae

Timeline for d1ce8a3:

• d1ce8a3 first appeared (with stable ids) in SCOP 1.55
  
• d1ce8a3 appears in SCOP 1.59
  
• d1ce8a3 appears in SCOP 1.63
  
• d1ce8a3 appears in the current release, SCOPe 2.08