Lineage for d5c67c_ (5c67 C:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259419Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2259420Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2259421Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 2259611Protein automated matches [190046] (4 species)
    not a true protein
  7. 2259653Species Macaca mulatta [TaxId:9544] [316879] (1 PDB entry)
  8. 2259654Domain d5c67c_: 5c67 C: [316880]
    Other proteins in same PDB: d5c67a_, d5c67b_
    automated match to d1ktha_

Details for d5c67c_

PDB Entry: 5c67 (more details), 1.83 Å

PDB Description: human mesotrypsin in complex with amyloid precursor protein inhibitor variant appi-m17g/i18f/f34v
PDB Compounds: (C:) amyloid beta a4 protein

SCOPe Domain Sequences for d5c67c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c67c_ g.8.1.1 (C:) automated matches {Macaca mulatta [TaxId: 9544]}
evcseqaetgpcragfsrwyfdvtegkcapfvyggcggnrnnfdteeycmavc

SCOPe Domain Coordinates for d5c67c_:

Click to download the PDB-style file with coordinates for d5c67c_.
(The format of our PDB-style files is described here.)

Timeline for d5c67c_:

  • d5c67c_ appears in periodic updates to SCOPe 2.06 starting on 2016-05-05
  • d5c67c_ appears in the current release, SCOPe 2.07, called d5c67c1