SCOPe 2.06: Domain d5c67c_: 5c67 C:

Lineage for d5c67c_ (5c67 C:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein automated matches [190046] (4 species)
   not a true protein

7. Species Macaca mulatta [TaxId:9544] [316879] (1 PDB entry)

8. Domain d5c67c_: 5c67 C: [316880]
   Other proteins in same PDB: d5c67a_, d5c67b_
   automated match to d1ktha_

Details for d5c67c_

PDB Entry: 5c67, 1.83 Å

PDB Description: human mesotrypsin in complex with amyloid precursor protein inhibitor variant appi-m17g/i18f/f34v

PDB Compounds: (C:) amyloid beta a4 protein

SCOPe Domain Sequences for d5c67c_:

Sequence; same for both SEQRES and ATOM records:

>d5c67c_ g.8.1.1 (C:) automated matches {Macaca mulatta [TaxId: 9544]}
evcseqaetgpcragfsrwyfdvtegkcapfvyggcggnrnnfdteeycmavc

Timeline for d5c67c_:

• d5c67c_ is new in SCOPe 2.06-stable
  
• d5c67c_ is called d5c67c1 in SCOPe 2.07
  
• d5c67c_ appears in the current release, SCOPe 2.08, called d5c67c1