SCOPe 2.08: Domain d5c67c1: 5c67 C:8-55

Lineage for d5c67c1 (5c67 C:8-55)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein automated matches [190046] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186911] (9 PDB entries)

8. Domain d5c67c1: 5c67 C:8-55 [316880]
   Other proteins in same PDB: d5c67a_, d5c67b_, d5c67c2, d5c67e2
   automated match to d1ktha_

Details for d5c67c1

PDB Entry: 5c67, 1.83 Å

PDB Description: human mesotrypsin in complex with amyloid precursor protein inhibitor variant appi-m17g/i18f/f34v

PDB Compounds: (C:) amyloid beta a4 protein

SCOPe Domain Sequences for d5c67c1:

Sequence; same for both SEQRES and ATOM records:

>d5c67c1 g.8.1.1 (C:8-55) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qaetgpcragfsrwyfdvtegkcapfvyggcggnrnnfdteeycmavc

Timeline for d5c67c1:

• d5c67c1 first appeared in SCOPe 2.06, called d5c67c_
  
• d5c67c1 appears in SCOPe 2.07