Lineage for d5c67c1 (5c67 C:8-55)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2583928Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2583929Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2583930Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 2584120Protein automated matches [190046] (3 species)
    not a true protein
  7. 2584151Species Human (Homo sapiens) [TaxId:9606] [186911] (9 PDB entries)
  8. 2584157Domain d5c67c1: 5c67 C:8-55 [316880]
    Other proteins in same PDB: d5c67a_, d5c67b_, d5c67c2, d5c67e2
    automated match to d1ktha_

Details for d5c67c1

PDB Entry: 5c67 (more details), 1.83 Å

PDB Description: human mesotrypsin in complex with amyloid precursor protein inhibitor variant appi-m17g/i18f/f34v
PDB Compounds: (C:) amyloid beta a4 protein

SCOPe Domain Sequences for d5c67c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c67c1 g.8.1.1 (C:8-55) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qaetgpcragfsrwyfdvtegkcapfvyggcggnrnnfdteeycmavc

SCOPe Domain Coordinates for d5c67c1:

Click to download the PDB-style file with coordinates for d5c67c1.
(The format of our PDB-style files is described here.)

Timeline for d5c67c1:

  • d5c67c1 first appeared in SCOPe 2.06, called d5c67c_