Lineage for d5broa2 (5bro A:200-552)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (6 proteins)
Glycosyl hydrolase family 20, GH20
automatically mapped to Pfam PF00728
Protein automated matches [237553] (2 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [316877] (1 PDB entry) 
Domain d5broa2: 5bro A:200-552 [316878]
Other proteins in same PDB: d5broa1
automated match to d1o7aa1
complexed with fmt, gol
Details for d5broa2
PDB Entry: 5bro (more details), 2.4 Å
PDB Description: crystal structure of modified hexb (modb)
PDB Compounds: (A:) Beta-hexosaminidase subunit betaSCOPe Domain Sequences for d5broa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5broa2 c.1.8.6 (A:200-552) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyqsitfpelsnkgs
yslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkgqkdlltpcysgsepldsf
gpinptlnttysflttffkeisevfpdqfihlggdevefkcwesnpkiqdfmrqkgfgtd
fkklesfyiqkvldiiatinkgsivwqevfddkaklapgtivevwkdsaypeelsrvtas
gfpvilsapwylnrisygqdwrkyykvepldfggtqkqkqlfiggeaclwgeyvdatnlt
prlwprasavgerlwsskdvrdmddaydrltrhrcrmvergiaaqplyagycn
SCOPe Domain Coordinates for d5broa2:
Click to download the PDB-style file with coordinates for d5broa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5broa2:
- d5broa2 first appeared in SCOPe 2.06
- d5broa2 appears in SCOPe 2.07
View in 3D
