Lineage for d5broa2 (5bro A:200-552)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418522Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (6 protein domains)
    Glycosyl hydrolase family 20, GH20
    automatically mapped to Pfam PF00728
  6. 2418574Protein automated matches [237553] (2 species)
    not a true protein
  7. 2418575Species Human (Homo sapiens) [TaxId:9606] [316877] (1 PDB entry)
  8. 2418576Domain d5broa2: 5bro A:200-552 [316878]
    Other proteins in same PDB: d5broa1
    automated match to d1o7aa1
    complexed with fmt, gol, nag

Details for d5broa2

PDB Entry: 5bro (more details), 2.4 Å

PDB Description: crystal structure of modified hexb (modb)
PDB Compounds: (A:) Beta-hexosaminidase subunit beta

SCOPe Domain Sequences for d5broa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5broa2 c.1.8.6 (A:200-552) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fshrgilidtsrhylpvkiilktldamafnkfnvlhwhivddqsfpyqsitfpelsnkgs
yslshvytpndvrmvieyarlrgirvlpefdtpghtlswgkgqkdlltpcysgsepldsf
gpinptlnttysflttffkeisevfpdqfihlggdevefkcwesnpkiqdfmrqkgfgtd
fkklesfyiqkvldiiatinkgsivwqevfddkaklapgtivevwkdsaypeelsrvtas
gfpvilsapwylnrisygqdwrkyykvepldfggtqkqkqlfiggeaclwgeyvdatnlt
prlwprasavgerlwsskdvrdmddaydrltrhrcrmvergiaaqplyagycn

SCOPe Domain Coordinates for d5broa2:

Click to download the PDB-style file with coordinates for d5broa2.
(The format of our PDB-style files is described here.)

Timeline for d5broa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5broa1