Lineage for d5c67b_ (5c67 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2387819Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2388843Protein Trypsin(ogen) [50515] (9 species)
  7. 2389325Species Human (Homo sapiens), trypsin IV (brain isoform) [TaxId:9606] [69283] (15 PDB entries)
  8. 2389345Domain d5c67b_: 5c67 B: [316876]
    Other proteins in same PDB: d5c67c1, d5c67c2, d5c67e1, d5c67e2
    automated match to d3p95a_

Details for d5c67b_

PDB Entry: 5c67 (more details), 1.83 Å

PDB Description: human mesotrypsin in complex with amyloid precursor protein inhibitor variant appi-m17g/i18f/f34v
PDB Compounds: (B:) Trypsin-3

SCOPe Domain Sequences for d5c67b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c67b_ b.47.1.2 (B:) Trypsin(ogen) {Human (Homo sapiens), trypsin IV (brain isoform) [TaxId: 9606]}
ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans

SCOPe Domain Coordinates for d5c67b_:

Click to download the PDB-style file with coordinates for d5c67b_.
(The format of our PDB-style files is described here.)

Timeline for d5c67b_: