SCOPe 2.08: Domain d5broa1: 5bro A:53-199

Lineage for d5broa1 (5bro A:53-199)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.0: automated matches [227269] (1 protein)
   not a true family

6. Protein automated matches [227062] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226074] (2 PDB entries)

8. Domain d5broa1: 5bro A:53-199 [316875]
   Other proteins in same PDB: d5broa2
   automated match to d1o7aa2
   complexed with fmt, gol

Details for d5broa1

PDB Entry: 5bro, 2.4 Å

PDB Description: crystal structure of modified hexb (modb)

PDB Compounds: (A:) Beta-hexosaminidase subunit beta

SCOPe Domain Sequences for d5broa1:

Sequence, based on SEQRES records:

>d5broa1 d.92.2.0 (A:53-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpalwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfykwh
hepaefqaktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgl
etfsqlvyqdsygtftinestiidspr

Sequence, based on observed residues (ATOM records):

>d5broa1 d.92.2.0 (A:53-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpalwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfqakt
qvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqd
sygtftinestiidspr

Timeline for d5broa1:

• d5broa1 first appeared in SCOPe 2.06
  
• d5broa1 appears in SCOPe 2.07