Lineage for d5fvfc_ (5fvf C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2184480Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2184481Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2185154Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2185155Protein automated matches [190526] (21 species)
    not a true protein
  7. 2185408Species Lobophyllia hemprichii [TaxId:46758] [187486] (21 PDB entries)
  8. 2185487Domain d5fvfc_: 5fvf C: [316865]
    Other proteins in same PDB: d5fvfa2, d5fvfb2
    automated match to d2vvjc_
    complexed with nh4, so4

Details for d5fvfc_

PDB Entry: 5fvf (more details), 2.75 Å

PDB Description: room temperature structure of irisfp determined by serial femtosecond crystallography.
PDB Compounds: (C:) green to red photoconvertible gpf-like protein eosfp

SCOPe Domain Sequences for d5fvfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fvfc_ d.22.1.0 (C:) automated matches {Lobophyllia hemprichii [TaxId: 46758]}
msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykak
ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn

SCOPe Domain Coordinates for d5fvfc_:

Click to download the PDB-style file with coordinates for d5fvfc_.
(The format of our PDB-style files is described here.)

Timeline for d5fvfc_: