Lineage for d1c3oe4 (1c3o E:556-676)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 482937Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 482938Superfamily c.30.1: PreATP-grasp domain [52440] (6 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 482939Family c.30.1.1: BC N-terminal domain-like [52441] (5 proteins)
  6. 482950Protein Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains [52450] (1 species)
    duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains
  7. 482951Species Escherichia coli [TaxId:562] [52451] (10 PDB entries)
  8. 482997Domain d1c3oe4: 1c3o E:556-676 [31686]
    Other proteins in same PDB: d1c3oa1, d1c3oa2, d1c3oa5, d1c3oa6, d1c3ob1, d1c3ob2, d1c3oc1, d1c3oc2, d1c3oc5, d1c3oc6, d1c3od1, d1c3od2, d1c3oe1, d1c3oe2, d1c3oe5, d1c3oe6, d1c3of1, d1c3of2, d1c3og1, d1c3og2, d1c3og5, d1c3og6, d1c3oh1, d1c3oh2

Details for d1c3oe4

PDB Entry: 1c3o (more details), 2.1 Å

PDB Description: crystal structure of the carbamoyl phosphate synthetase: small subunit mutant c269s with bound glutamine

SCOP Domain Sequences for d1c3oe4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3oe4 c.30.1.1 (E:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli}
stdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvncnpetvstdydtsdr
lyfepvtledvleivriekpkgvivqyggqtplklaraleaagvpvigtspdaidraedr
e

SCOP Domain Coordinates for d1c3oe4:

Click to download the PDB-style file with coordinates for d1c3oe4.
(The format of our PDB-style files is described here.)

Timeline for d1c3oe4: