SCOPe 2.08: Domain d5j89a1: 5j89 A:18-134

Lineage for d5j89a1 (5j89 A:18-134)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5j89a1: 5j89 A:18-134 [316845]
   Other proteins in same PDB: d5j89a2, d5j89b2, d5j89c2, d5j89d2
   automated match to d3bova_
   complexed with 6gx, edo

Details for d5j89a1

PDB Entry: 5j89, 2.2 Å

PDB Description: structure of human programmed cell death 1 ligand 1 (pd-l1) with low molecular mass inhibitor

PDB Compounds: (A:) Programmed cell death 1 ligand 1

SCOPe Domain Sequences for d5j89a1:

Sequence; same for both SEQRES and ATOM records:

>d5j89a1 b.1.1.0 (A:18-134) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aftvtvpkdlyvveygsnmtieckfpvekqldlaalivywemedkniiqfvhgeedlkvq
hssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapy

Timeline for d5j89a1:

• d5j89a1 first appeared in SCOPe 2.06
  
• d5j89a1 appears in SCOPe 2.07