SCOPe 2.08: Domain d5i71c2: 5i71 C:128-234

Lineage for d5i71c2 (5i71 C:128-234)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d5i71c2: 5i71 C:128-234 [316841]
   Other proteins in same PDB: d5i71b_, d5i71c1
   automated match to d1tqbc2
   complexed with 68p, clr, d12, hex, na, nag

Details for d5i71c2

PDB Entry: 5i71, 3.15 Å

PDB Description: x-ray structure of the ts3 human serotonin transporter complexed with s-citalopram at the central site

PDB Compounds: (C:) 8B6 antibody, light chain

SCOPe Domain Sequences for d5i71c2:

Sequence; same for both SEQRES and ATOM records:

>d5i71c2 b.1.1.2 (C:128-234) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d5i71c2:

• d5i71c2 first appeared in SCOPe 2.06
  
• d5i71c2 appears in SCOPe 2.07