Lineage for d5i71c2 (5i71 C:128-234)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753053Domain d5i71c2: 5i71 C:128-234 [316841]
    Other proteins in same PDB: d5i71b_, d5i71c1
    automated match to d1tqbc2
    complexed with 68p, clr, d12, hex, na, nag

Details for d5i71c2

PDB Entry: 5i71 (more details), 3.15 Å

PDB Description: x-ray structure of the ts3 human serotonin transporter complexed with s-citalopram at the central site
PDB Compounds: (C:) 8B6 antibody, light chain

SCOPe Domain Sequences for d5i71c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i71c2 b.1.1.2 (C:128-234) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d5i71c2:

Click to download the PDB-style file with coordinates for d5i71c2.
(The format of our PDB-style files is described here.)

Timeline for d5i71c2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5i71c1
View in 3D
Domains from other chains:
(mouse over for more information)
d5i71b_