SCOPe 2.08: Domain d5j46a1: 5j46 A:15-181

Lineage for d5j46a1 (5j46 A:15-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.0: automated matches [191587] (1 protein)
   not a true family

6. Protein automated matches [191055] (20 species)
   not a true protein

7. Species Burkholderia multivorans [TaxId:395019] [315513] (2 PDB entries)

8. Domain d5j46a1: 5j46 A:15-181 [316827]
   Other proteins in same PDB: d5j46a2
   automated match to d4wxkc_
   complexed with edo, zn

Details for d5j46a1

PDB Entry: 5j46, 1.95 Å

PDB Description: crystal structure of a peptide deformylase from burkholderia multivorans

PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d5j46a1:

Sequence; same for both SEQRES and ATOM records:

>d5j46a1 d.167.1.0 (A:15-181) automated matches {Burkholderia multivorans [TaxId: 395019]}
mallnilhypdkrlhkvakpvdkvddrirklvadmaetmyaapgiglaatqvdvherviv
idvsedknelrafinpeiiwssdgkqvyeegclsvpgiydeverpdrvrvralneqgetf
eldcegllavciqhemdhlmgrvfveylsplkqsriktkmkkleram

Timeline for d5j46a1:

• d5j46a1 first appeared in SCOPe 2.06
  
• d5j46a1 appears in SCOPe 2.07