![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
![]() | Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
![]() | Protein automated matches [226927] (16 species) not a true protein |
![]() | Species Toxoplasma gondii [TaxId:5811] [316116] (1 PDB entry) |
![]() | Domain d5j3ua1: 5j3u A:158-278 [316824] Other proteins in same PDB: d5j3ua3 automated match to d4jv4a1 complexed with cmp, gol |
PDB Entry: 5j3u (more details), 1.8 Å
SCOPe Domain Sequences for d5j3ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j3ua1 b.82.3.0 (A:158-278) automated matches {Toxoplasma gondii [TaxId: 5811]} rilrqsflfnsldekdlntvilamqekkieastcliregddgeclyivqsgelncsklid geervvkvvgpgdafgelallynapraatvtsvsacdlwelgrdtfnaivkdaatkrrsm y
Timeline for d5j3ua1: