Lineage for d5ibka2 (5ibk A:82-156)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017816Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 2017817Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 2017818Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)
  6. 2017845Protein automated matches [226933] (1 species)
    not a true protein
  7. 2017846Species Human (Homo sapiens) [TaxId:9606] [225235] (6 PDB entries)
  8. 2017849Domain d5ibka2: 5ibk A:82-156 [316812]
    Other proteins in same PDB: d5ibka1, d5ibka3, d5ibkc_, d5ibkd1, d5ibkf_
    automated match to d3wsob2

Details for d5ibka2

PDB Entry: 5ibk (more details), 2.5 Å

PDB Description: skp1-f-box in complex with a ubiquitin variant
PDB Compounds: (A:) S-phase kinase-associated protein 1,S-phase kinase-associated protein 1

SCOPe Domain Sequences for d5ibka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ibka2 a.157.1.1 (A:82-156) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfni
kndfteeeeaqvrke

SCOPe Domain Coordinates for d5ibka2:

Click to download the PDB-style file with coordinates for d5ibka2.
(The format of our PDB-style files is described here.)

Timeline for d5ibka2: