| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily) multihelical; interlocked heterodimer with F-box proteins |
Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) ![]() automatically mapped to Pfam PF01466 |
| Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins) |
| Protein automated matches [226933] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225235] (12 PDB entries) |
| Domain d5ibka2: 5ibk A:82-156 [316812] Other proteins in same PDB: d5ibka1, d5ibka3, d5ibkc_, d5ibkd1, d5ibkf_ automated match to d3wsob2 |
PDB Entry: 5ibk (more details), 2.5 Å
SCOPe Domain Sequences for d5ibka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ibka2 a.157.1.1 (A:82-156) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfni
kndfteeeeaqvrke
Timeline for d5ibka2:
View in 3DDomains from other chains: (mouse over for more information) d5ibkc_, d5ibkd1, d5ibkd2, d5ibkf_ |