Lineage for d5ibka1 (5ibk A:1-70)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2189359Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2189360Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2189641Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2189642Protein automated matches [190710] (3 species)
    not a true protein
  7. 2189643Species Human (Homo sapiens) [TaxId:9606] [187857] (39 PDB entries)
  8. 2189712Domain d5ibka1: 5ibk A:1-70 [316811]
    Other proteins in same PDB: d5ibka2, d5ibka3, d5ibkc_, d5ibkd2, d5ibkf_
    automated match to d3wsob1

Details for d5ibka1

PDB Entry: 5ibk (more details), 2.5 Å

PDB Description: skp1-f-box in complex with a ubiquitin variant
PDB Compounds: (A:) S-phase kinase-associated protein 1,S-phase kinase-associated protein 1

SCOPe Domain Sequences for d5ibka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ibka1 d.42.1.0 (A:1-70) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpsiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhk
ddpg

SCOPe Domain Coordinates for d5ibka1:

Click to download the PDB-style file with coordinates for d5ibka1.
(The format of our PDB-style files is described here.)

Timeline for d5ibka1: