Lineage for d5iduc2 (5idu C:239-397)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993780Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1994829Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1994963Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 1994964Protein automated matches [226935] (26 species)
    not a true protein
  7. 1995004Species Burkholderia phymatum [TaxId:391038] [314997] (1 PDB entry)
  8. 1995007Domain d5iduc2: 5idu C:239-397 [316808]
    Other proteins in same PDB: d5idua1, d5idub1, d5iduc1, d5iduc3, d5idud1
    automated match to d5idua2
    complexed with edo, fad

Details for d5iduc2

PDB Entry: 5idu (more details), 1.95 Å

PDB Description: crystal structure of an acyl-coa dehydrogenase domain protein from burkholderia phymatum bound to fad
PDB Compounds: (C:) Acyl-CoA dehydrogenase domain protein

SCOPe Domain Sequences for d5iduc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iduc2 a.29.3.0 (C:239-397) automated matches {Burkholderia phymatum [TaxId: 391038]}
gegfkiamrtldvfrtsvaaaslgfarralqeglaraasrkmfgqtlgdfqltqtklaqm
altidssallvyraawlrdqgenvtreaamakwhasegaqqvidaavqlwggmgvqsgtt
verlyreiralriyegatevqqlivgrdllkahaaqrqq

SCOPe Domain Coordinates for d5iduc2:

Click to download the PDB-style file with coordinates for d5iduc2.
(The format of our PDB-style files is described here.)

Timeline for d5iduc2: