SCOPe 2.07: Domain d5iduc1: 5idu C:2-238

Lineage for d5iduc1 (5idu C:2-238)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (29 species)
   not a true protein

7. Species Burkholderia phymatum [TaxId:391038] [314995] (1 PDB entry)

8. Domain d5iduc1: 5idu C:2-238 [316807]
   Other proteins in same PDB: d5idua2, d5idub2, d5iduc2, d5iduc3, d5idud2
   automated match to d5idua1
   complexed with edo, fad

Details for d5iduc1

PDB Entry: 5idu, 1.95 Å

PDB Description: crystal structure of an acyl-coa dehydrogenase domain protein from burkholderia phymatum bound to fad

PDB Compounds: (C:) Acyl-CoA dehydrogenase domain protein

SCOPe Domain Sequences for d5iduc1:

Sequence; same for both SEQRES and ATOM records:

>d5iduc1 e.6.1.0 (C:2-238) automated matches {Burkholderia phymatum [TaxId: 391038]}
aanlidphgalawpffearhrelaagieawatqhlacvqhddtdttcrklvralgeagwl
kygvggaqygghgdtidtravcllretlanhdgladfalamqglgsgaitlagtheqkir
ylprvskgeaiaafalsepdagsdvaamslqaraegdcyvidgdktwisnggiadfyvvf
artgeapgargisafivdadtpglqiaeridviaphplarlhfdsarvprsqmlgap

Timeline for d5iduc1:

• d5iduc1 first appeared in SCOPe 2.06
  
• d5iduc1 appears in the current release, SCOPe 2.08