Lineage for d5iduc1 (5idu C:2-238)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015483Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 3015484Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 3015629Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 3015630Protein automated matches [226934] (29 species)
    not a true protein
  7. 3015673Species Burkholderia phymatum [TaxId:391038] [314995] (1 PDB entry)
  8. 3015676Domain d5iduc1: 5idu C:2-238 [316807]
    Other proteins in same PDB: d5idua2, d5idub2, d5iduc2, d5iduc3, d5idud2
    automated match to d5idua1
    complexed with edo, fad

Details for d5iduc1

PDB Entry: 5idu (more details), 1.95 Å

PDB Description: crystal structure of an acyl-coa dehydrogenase domain protein from burkholderia phymatum bound to fad
PDB Compounds: (C:) Acyl-CoA dehydrogenase domain protein

SCOPe Domain Sequences for d5iduc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iduc1 e.6.1.0 (C:2-238) automated matches {Burkholderia phymatum [TaxId: 391038]}
aanlidphgalawpffearhrelaagieawatqhlacvqhddtdttcrklvralgeagwl
kygvggaqygghgdtidtravcllretlanhdgladfalamqglgsgaitlagtheqkir
ylprvskgeaiaafalsepdagsdvaamslqaraegdcyvidgdktwisnggiadfyvvf
artgeapgargisafivdadtpglqiaeridviaphplarlhfdsarvprsqmlgap

SCOPe Domain Coordinates for d5iduc1:

Click to download the PDB-style file with coordinates for d5iduc1.
(The format of our PDB-style files is described here.)

Timeline for d5iduc1: