Lineage for d5ibkd2 (5ibk D:83-160)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341036Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 2341037Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 2341038Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 protein domains)
  6. 2341065Protein automated matches [226933] (1 species)
    not a true protein
  7. 2341066Species Human (Homo sapiens) [TaxId:9606] [225235] (10 PDB entries)
  8. 2341070Domain d5ibkd2: 5ibk D:83-160 [316801]
    Other proteins in same PDB: d5ibka1, d5ibka3, d5ibkc_, d5ibkd1, d5ibkf_
    automated match to d3wsob2

Details for d5ibkd2

PDB Entry: 5ibk (more details), 2.5 Å

PDB Description: skp1-f-box in complex with a ubiquitin variant
PDB Compounds: (D:) S-phase kinase-associated protein 1,S-phase kinase-associated protein 1

SCOPe Domain Sequences for d5ibkd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ibkd2 a.157.1.1 (D:83-160) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfnik
ndfteeeeaqvrkenqwc

SCOPe Domain Coordinates for d5ibkd2:

Click to download the PDB-style file with coordinates for d5ibkd2.
(The format of our PDB-style files is described here.)

Timeline for d5ibkd2: