SCOPe 2.08: Domain d5ibkd2: 5ibk D:83-160

Lineage for d5ibkd2 (5ibk D:83-160)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
   multihelical; interlocked heterodimer with F-box proteins

4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families)
   automatically mapped to Pfam PF01466

5. Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)

6. Protein automated matches [226933] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225235] (12 PDB entries)

8. Domain d5ibkd2: 5ibk D:83-160 [316801]
   Other proteins in same PDB: d5ibka1, d5ibka3, d5ibkc_, d5ibkd1, d5ibkf_
   automated match to d3wsob2

Details for d5ibkd2

PDB Entry: 5ibk, 2.5 Å

PDB Description: skp1-f-box in complex with a ubiquitin variant

PDB Compounds: (D:) S-phase kinase-associated protein 1,S-phase kinase-associated protein 1

SCOPe Domain Sequences for d5ibkd2:

Sequence; same for both SEQRES and ATOM records:

>d5ibkd2 a.157.1.1 (D:83-160) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfnik
ndfteeeeaqvrkenqwc

Timeline for d5ibkd2:

• d5ibkd2 first appeared in SCOPe 2.06
  
• d5ibkd2 appears in SCOPe 2.07